Placeholder image of a protein
Icon representing a puzzle

1914: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 06, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,459
  2. Avatar for Team China 12. Team China 1 pt. 10,248
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,211
  4. Avatar for CH3F1 14. CH3F1 1 pt. 9,795
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,991
  6. Avatar for Window Group 16. Window Group 1 pt. 8,965
  1. Avatar for Bruno Kestemont 21. Bruno Kestemont Lv 1 52 pts. 11,604
  2. Avatar for APPAAP 22. APPAAP Lv 1 50 pts. 11,601
  3. Avatar for christioanchauvin 23. christioanchauvin Lv 1 48 pts. 11,592
  4. Avatar for Phyx 24. Phyx Lv 1 47 pts. 11,591
  5. Avatar for robgee 25. robgee Lv 1 45 pts. 11,590
  6. Avatar for Deleted player 26. Deleted player 44 pts. 11,576
  7. Avatar for Enzyme 27. Enzyme Lv 1 42 pts. 11,561
  8. Avatar for BootsMcGraw 28. BootsMcGraw Lv 1 40 pts. 11,503
  9. Avatar for Skippysk8s 29. Skippysk8s Lv 1 39 pts. 11,450
  10. Avatar for John McLeod 30. John McLeod Lv 1 38 pts. 11,441

Comments