Placeholder image of a protein
Icon representing a puzzle

1914: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
November 06, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,459
  2. Avatar for Team China 12. Team China 1 pt. 10,248
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,211
  4. Avatar for CH3F1 14. CH3F1 1 pt. 9,795
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,991
  6. Avatar for Window Group 16. Window Group 1 pt. 8,965

  1. Avatar for Vinara 62. Vinara Lv 1 10 pts. 10,855
  2. Avatar for Trajan464 63. Trajan464 Lv 1 9 pts. 10,837
  3. Avatar for BarrySampson 64. BarrySampson Lv 1 9 pts. 10,826
  4. Avatar for alcor29 65. alcor29 Lv 1 8 pts. 10,818
  5. Avatar for stomjoh 66. stomjoh Lv 1 8 pts. 10,810
  6. Avatar for CAN1958 67. CAN1958 Lv 1 8 pts. 10,809
  7. Avatar for zippyc137 68. zippyc137 Lv 1 7 pts. 10,806
  8. Avatar for infjamc 69. infjamc Lv 1 7 pts. 10,784
  9. Avatar for diamonddays 70. diamonddays Lv 1 7 pts. 10,779

Comments