Placeholder image of a protein
Icon representing a puzzle

1914: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 06, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,459
  2. Avatar for Team China 12. Team China 1 pt. 10,248
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,211
  4. Avatar for CH3F1 14. CH3F1 1 pt. 9,795
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,991
  6. Avatar for Window Group 16. Window Group 1 pt. 8,965
  1. Avatar for Karlheinz 71. Karlheinz Lv 1 6 pts. 10,767
  2. Avatar for cjddig 72. cjddig Lv 1 6 pts. 10,762
  3. Avatar for Todd6485577 73. Todd6485577 Lv 1 6 pts. 10,745
  4. Avatar for Pawel Tluscik 74. Pawel Tluscik Lv 1 5 pts. 10,739
  5. Avatar for rezaefar 75. rezaefar Lv 1 5 pts. 10,734
  6. Avatar for Hellcat6 76. Hellcat6 Lv 1 5 pts. 10,729
  7. Avatar for jausmh 77. jausmh Lv 1 5 pts. 10,722
  8. Avatar for matt61ger 78. matt61ger Lv 1 4 pts. 10,718
  9. Avatar for tracybutt 79. tracybutt Lv 1 4 pts. 10,702
  10. Avatar for zackallen 80. zackallen Lv 1 4 pts. 10,700

Comments