Placeholder image of a protein
Icon representing a puzzle

1914: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 06, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,909
  2. Avatar for Go Science 2. Go Science 71 pts. 11,834
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 11,792
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 11,706
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 11,689
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 11,673
  7. Avatar for Contenders 7. Contenders 8 pts. 11,503
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 10,909
  9. Avatar for Hold My Beer 9. Hold My Beer 3 pts. 10,745
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 10,542
  1. Avatar for fisherlr777 11. fisherlr777 Lv 1 6 pts. 11,786
  2. Avatar for MicElephant 12. MicElephant Lv 1 4 pts. 11,773
  3. Avatar for ichwilldiesennamen 13. ichwilldiesennamen Lv 1 3 pts. 11,754
  4. Avatar for jausmh 14. jausmh Lv 1 2 pts. 11,706
  5. Avatar for Galaxie 15. Galaxie Lv 1 1 pt. 11,629
  6. Avatar for Pazithi 16. Pazithi Lv 1 1 pt. 11,551
  7. Avatar for robgee 17. robgee Lv 1 1 pt. 11,547
  8. Avatar for alcor29 18. alcor29 Lv 1 1 pt. 11,546
  9. Avatar for Mike Lewis 19. Mike Lewis Lv 1 1 pt. 11,535
  10. Avatar for OWM3 20. OWM3 Lv 1 1 pt. 11,532

Comments