Placeholder image of a protein
Icon representing a puzzle

1914: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
November 06, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Beta Folders 100 pts. 11,909
  2. Avatar for Go Science 2. Go Science 71 pts. 11,834
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 11,792
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 11,706
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 11,689
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 11,673
  7. Avatar for Contenders 7. Contenders 8 pts. 11,503
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 10,909
  9. Avatar for Hold My Beer 9. Hold My Beer 3 pts. 10,745
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 10,542

  1. Avatar for Sydefecks 141. Sydefecks Lv 1 1 pt. 9,504
  2. Avatar for Auntecedent 142. Auntecedent Lv 1 1 pt. 9,411
  3. Avatar for folditusername14 143. folditusername14 Lv 1 1 pt. 9,275
  4. Avatar for tutianshuo 144. tutianshuo Lv 1 1 pt. 9,201
  5. Avatar for erasmus.wu.hui 145. erasmus.wu.hui Lv 1 1 pt. 9,188
  6. Avatar for shogi 146. shogi Lv 1 1 pt. 9,176
  7. Avatar for 01010011111 147. 01010011111 Lv 1 1 pt. 9,174
  8. Avatar for 0r3rv1ew 148. 0r3rv1ew Lv 1 1 pt. 9,170
  9. Avatar for RAN0043 149. RAN0043 Lv 1 1 pt. 9,029
  10. Avatar for rmoretti 150. rmoretti Lv 1 1 pt. 8,991

Comments