Placeholder image of a protein
Icon representing a puzzle

1914: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 06, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,909
  2. Avatar for Go Science 2. Go Science 71 pts. 11,834
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 49 pts. 11,792
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 11,706
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 11,689
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 11,673
  7. Avatar for Contenders 7. Contenders 8 pts. 11,503
  8. Avatar for BOINC@Poland 8. BOINC@Poland 5 pts. 10,909
  9. Avatar for Hold My Beer 9. Hold My Beer 3 pts. 10,745
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 10,542
  1. Avatar for AlkiP0Ps 121. AlkiP0Ps Lv 1 1 pt. 9,942
  2. Avatar for pruneau_44 122. pruneau_44 Lv 1 1 pt. 9,928
  3. Avatar for Thule 123. Thule Lv 1 1 pt. 9,926
  4. Avatar for proteininfected 124. proteininfected Lv 1 1 pt. 9,915
  5. Avatar for Sphinxian 125. Sphinxian Lv 1 1 pt. 9,902
  6. Avatar for Maedr0s 126. Maedr0s Lv 1 1 pt. 9,894
  7. Avatar for AAGreen 127. AAGreen Lv 1 1 pt. 9,869
  8. Avatar for The Antichrist 128. The Antichrist Lv 1 1 pt. 9,838
  9. Avatar for ume 129. ume Lv 1 1 pt. 9,828
  10. Avatar for nmassot 130. nmassot Lv 1 1 pt. 9,804

Comments