Placeholder image of a protein
Icon representing a puzzle

1917: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
November 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 11,052
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 11,032
  3. Avatar for Team China 13. Team China 1 pt. 10,986
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,770
  5. Avatar for CH3F1 15. CH3F1 1 pt. 10,520
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 10,202
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,941
  8. Avatar for Window Group 18. Window Group 1 pt. 9,941
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 9,348

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,045
  2. Avatar for Deleted player 2. Deleted player 71 pts. 12,021
  3. Avatar for mirp 3. mirp Lv 1 49 pts. 11,992
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 33 pts. 11,989
  5. Avatar for ichwilldiesennamen 5. ichwilldiesennamen Lv 1 22 pts. 11,987
  6. Avatar for Galaxie 6. Galaxie Lv 1 14 pts. 11,930
  7. Avatar for silent gene 7. silent gene Lv 1 8 pts. 11,890
  8. Avatar for isaksson 8. isaksson Lv 1 5 pts. 11,884
  9. Avatar for fisherlr777 9. fisherlr777 Lv 1 3 pts. 11,882
  10. Avatar for kyoota 10. kyoota Lv 1 2 pts. 11,881

Comments