Placeholder image of a protein
Icon representing a puzzle

1917: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 11,052
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 11,032
  3. Avatar for Team China 13. Team China 1 pt. 10,986
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,770
  5. Avatar for CH3F1 15. CH3F1 1 pt. 10,520
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 10,202
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,941
  8. Avatar for Window Group 18. Window Group 1 pt. 9,941
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 9,348
  1. Avatar for zannipietro 91. zannipietro Lv 1 2 pts. 11,110
  2. Avatar for jsfoldingaccount 92. jsfoldingaccount Lv 1 1 pt. 11,105
  3. Avatar for Bearpaw 93. Bearpaw Lv 1 1 pt. 11,079
  4. Avatar for zippyc137 94. zippyc137 Lv 1 1 pt. 11,072
  5. Avatar for JasperD 95. JasperD Lv 1 1 pt. 11,052
  6. Avatar for abiogenesis 96. abiogenesis Lv 1 1 pt. 11,044
  7. Avatar for Mike Cassidy 97. Mike Cassidy Lv 1 1 pt. 11,032
  8. Avatar for zo3xiaJonWeinberg 98. zo3xiaJonWeinberg Lv 1 1 pt. 10,986
  9. Avatar for Trajan464 99. Trajan464 Lv 1 1 pt. 10,983
  10. Avatar for frostschutz 100. frostschutz Lv 1 1 pt. 10,980

Comments