Placeholder image of a protein
Icon representing a puzzle

1917: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 11,052
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 11,032
  3. Avatar for Team China 13. Team China 1 pt. 10,986
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,770
  5. Avatar for CH3F1 15. CH3F1 1 pt. 10,520
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 10,202
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,941
  8. Avatar for Window Group 18. Window Group 1 pt. 9,941
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 9,348
  1. Avatar for Pdor Figlio di Kmer 121. Pdor Figlio di Kmer Lv 1 1 pt. 10,590
  2. Avatar for dTech 122. dTech Lv 1 1 pt. 10,586
  3. Avatar for 4block 123. 4block Lv 1 1 pt. 10,582
  4. Avatar for CH3F1-Magiera 124. CH3F1-Magiera Lv 1 1 pt. 10,520
  5. Avatar for illex 125. illex Lv 1 1 pt. 10,516
  6. Avatar for mike2347 126. mike2347 Lv 1 1 pt. 10,511
  7. Avatar for lacie 127. lacie Lv 1 1 pt. 10,476
  8. Avatar for nmassot 128. nmassot Lv 1 1 pt. 10,467
  9. Avatar for Pikkachurin 129. Pikkachurin Lv 1 1 pt. 10,460
  10. Avatar for fabiodavilla 130. fabiodavilla Lv 1 1 pt. 10,456

Comments