Placeholder image of a protein
Icon representing a puzzle

1917: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 11,052
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 11,032
  3. Avatar for Team China 13. Team China 1 pt. 10,986
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,770
  5. Avatar for CH3F1 15. CH3F1 1 pt. 10,520
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 10,202
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,941
  8. Avatar for Window Group 18. Window Group 1 pt. 9,941
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 9,348
  1. Avatar for jflat06 141. jflat06 Lv 1 1 pt. 9,941
  2. Avatar for NicolasSenn 142. NicolasSenn Lv 1 1 pt. 9,876
  3. Avatar for Matze1969 143. Matze1969 Lv 1 1 pt. 9,708
  4. Avatar for Plaxerone 144. Plaxerone Lv 1 1 pt. 9,464
  5. Avatar for mcoope38 145. mcoope38 Lv 1 1 pt. 9,379
  6. Avatar for devjosh 146. devjosh Lv 1 1 pt. 9,348
  7. Avatar for bkoep 147. bkoep Lv 1 1 pt. 9,348
  8. Avatar for Xeira 148. Xeira Lv 1 1 pt. 9,348
  9. Avatar for JUMELLE54 149. JUMELLE54 Lv 1 1 pt. 9,348
  10. Avatar for HuubR 150. HuubR Lv 1 1 pt. 9,348

Comments