Placeholder image of a protein
Icon representing a puzzle

1917: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 11,052
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 11,032
  3. Avatar for Team China 13. Team China 1 pt. 10,986
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,770
  5. Avatar for CH3F1 15. CH3F1 1 pt. 10,520
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 10,202
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,941
  8. Avatar for Window Group 18. Window Group 1 pt. 9,941
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 9,348
  1. Avatar for NinjaGreg 21. NinjaGreg Lv 1 49 pts. 11,825
  2. Avatar for MicElephant 22. MicElephant Lv 1 48 pts. 11,815
  3. Avatar for Threeoak 23. Threeoak Lv 1 46 pts. 11,803
  4. Avatar for phi16 24. phi16 Lv 1 44 pts. 11,803
  5. Avatar for ichwilldiesennamen 25. ichwilldiesennamen Lv 1 42 pts. 11,801
  6. Avatar for Enzyme 26. Enzyme Lv 1 41 pts. 11,796
  7. Avatar for GuR0 27. GuR0 Lv 1 39 pts. 11,781
  8. Avatar for drjr 28. drjr Lv 1 38 pts. 11,781
  9. Avatar for fiendish_ghoul 29. fiendish_ghoul Lv 1 36 pts. 11,745
  10. Avatar for robgee 30. robgee Lv 1 35 pts. 11,742

Comments