Placeholder image of a protein
Icon representing a puzzle

1917: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 11,052
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 11,032
  3. Avatar for Team China 13. Team China 1 pt. 10,986
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,770
  5. Avatar for CH3F1 15. CH3F1 1 pt. 10,520
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 10,202
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,941
  8. Avatar for Window Group 18. Window Group 1 pt. 9,941
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 9,348
  1. Avatar for Skippysk8s 31. Skippysk8s Lv 1 33 pts. 11,733
  2. Avatar for Norrjane 32. Norrjane Lv 1 32 pts. 11,732
  3. Avatar for akaaka 33. akaaka Lv 1 31 pts. 11,728
  4. Avatar for christioanchauvin 34. christioanchauvin Lv 1 29 pts. 11,723
  5. Avatar for BarrySampson 35. BarrySampson Lv 1 28 pts. 11,721
  6. Avatar for Lotus23 36. Lotus23 Lv 1 27 pts. 11,666
  7. Avatar for hansvandenhof 37. hansvandenhof Lv 1 26 pts. 11,644
  8. Avatar for silent gene 38. silent gene Lv 1 25 pts. 11,638
  9. Avatar for alcor29 39. alcor29 Lv 1 24 pts. 11,626
  10. Avatar for ucad 40. ucad Lv 1 23 pts. 11,621

Comments