Placeholder image of a protein
Icon representing a puzzle

1917: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 11,052
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 11,032
  3. Avatar for Team China 13. Team China 1 pt. 10,986
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,770
  5. Avatar for CH3F1 15. CH3F1 1 pt. 10,520
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 10,202
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,941
  8. Avatar for Window Group 18. Window Group 1 pt. 9,941
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 9,348
  1. Avatar for John McLeod 41. John McLeod Lv 1 22 pts. 11,620
  2. Avatar for Anfinsen_slept_here 42. Anfinsen_slept_here Lv 1 21 pts. 11,618
  3. Avatar for martinzblavy 43. martinzblavy Lv 1 20 pts. 11,557
  4. Avatar for WBarme1234 44. WBarme1234 Lv 1 19 pts. 11,555
  5. Avatar for FractalCuber 45. FractalCuber Lv 1 18 pts. 11,547
  6. Avatar for Vinara 46. Vinara Lv 1 17 pts. 11,524
  7. Avatar for jausmh 47. jausmh Lv 1 17 pts. 11,488
  8. Avatar for 181818 48. 181818 Lv 1 16 pts. 11,481
  9. Avatar for dpmattingly 49. dpmattingly Lv 1 15 pts. 11,481
  10. Avatar for Glen B 50. Glen B Lv 1 14 pts. 11,480

Comments