Placeholder image of a protein
Icon representing a puzzle

1917: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 11,052
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 11,032
  3. Avatar for Team China 13. Team China 1 pt. 10,986
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,770
  5. Avatar for CH3F1 15. CH3F1 1 pt. 10,520
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 10,202
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,941
  8. Avatar for Window Group 18. Window Group 1 pt. 9,941
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 9,348
  1. Avatar for jamiexq 51. jamiexq Lv 1 14 pts. 11,469
  2. Avatar for OWM3 52. OWM3 Lv 1 13 pts. 11,455
  3. Avatar for KarenCH 53. KarenCH Lv 1 12 pts. 11,450
  4. Avatar for Formula350 54. Formula350 Lv 1 12 pts. 11,441
  5. Avatar for cjddig 55. cjddig Lv 1 11 pts. 11,417
  6. Avatar for maithra 56. maithra Lv 1 11 pts. 11,417
  7. Avatar for ProfVince 57. ProfVince Lv 1 10 pts. 11,405
  8. Avatar for zackallen 58. zackallen Lv 1 10 pts. 11,402
  9. Avatar for heather-1 59. heather-1 Lv 1 9 pts. 11,400
  10. Avatar for alwen 60. alwen Lv 1 9 pts. 11,390

Comments