Placeholder image of a protein
Icon representing a puzzle

1917: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 11,052
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 11,032
  3. Avatar for Team China 13. Team China 1 pt. 10,986
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,770
  5. Avatar for CH3F1 15. CH3F1 1 pt. 10,520
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 10,202
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,941
  8. Avatar for Window Group 18. Window Group 1 pt. 9,941
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 9,348
  1. Avatar for tracybutt 61. tracybutt Lv 1 8 pts. 11,378
  2. Avatar for xythus 62. xythus Lv 1 8 pts. 11,353
  3. Avatar for Hellcat6 63. Hellcat6 Lv 1 7 pts. 11,350
  4. Avatar for Tygh 64. Tygh Lv 1 7 pts. 11,347
  5. Avatar for fishercat 65. fishercat Lv 1 7 pts. 11,345
  6. Avatar for donuts554 66. donuts554 Lv 1 6 pts. 11,322
  7. Avatar for CAN1958 67. CAN1958 Lv 1 6 pts. 11,319
  8. Avatar for kyoota 68. kyoota Lv 1 6 pts. 11,309
  9. Avatar for Bruno Kestemont 69. Bruno Kestemont Lv 1 5 pts. 11,305
  10. Avatar for Dhalion 70. Dhalion Lv 1 5 pts. 11,299

Comments