Placeholder image of a protein
Icon representing a puzzle

1917: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 11,052
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 11,032
  3. Avatar for Team China 13. Team China 1 pt. 10,986
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,770
  5. Avatar for CH3F1 15. CH3F1 1 pt. 10,520
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 10,202
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,941
  8. Avatar for Window Group 18. Window Group 1 pt. 9,941
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 9,348
  1. Avatar for Blipperman 71. Blipperman Lv 1 5 pts. 11,291
  2. Avatar for vybi 72. vybi Lv 1 5 pts. 11,289
  3. Avatar for vuvuvu 73. vuvuvu Lv 1 4 pts. 11,269
  4. Avatar for Mike Lewis 74. Mike Lewis Lv 1 4 pts. 11,265
  5. Avatar for Karlheinz 75. Karlheinz Lv 1 4 pts. 11,263
  6. Avatar for Pawel Tluscik 76. Pawel Tluscik Lv 1 4 pts. 11,254
  7. Avatar for Jumper2 77. Jumper2 Lv 1 3 pts. 11,250
  8. Avatar for fisherlr777 78. fisherlr777 Lv 1 3 pts. 11,247
  9. Avatar for equilibria 79. equilibria Lv 1 3 pts. 11,226
  10. Avatar for NeLikomSheet 80. NeLikomSheet Lv 1 3 pts. 11,221

Comments