Placeholder image of a protein
Icon representing a puzzle

1917: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 11,052
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 11,032
  3. Avatar for Team China 13. Team China 1 pt. 10,986
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,770
  5. Avatar for CH3F1 15. CH3F1 1 pt. 10,520
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 10,202
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,941
  8. Avatar for Window Group 18. Window Group 1 pt. 9,941
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 9,348

  1. Avatar for isaksson 81. isaksson Lv 1 3 pts. 11,213
  2. Avatar for roman madala 82. roman madala Lv 1 3 pts. 11,195
  3. Avatar for Lbuettner 83. Lbuettner Lv 1 2 pts. 11,182
  4. Avatar for fearjuan 84. fearjuan Lv 1 2 pts. 11,156
  5. Avatar for infjamc 85. infjamc Lv 1 2 pts. 11,147
  6. Avatar for ShadowTactics 86. ShadowTactics Lv 1 2 pts. 11,141
  7. Avatar for hada 87. hada Lv 1 2 pts. 11,141
  8. Avatar for NPrincipi 88. NPrincipi Lv 1 2 pts. 11,138
  9. Avatar for Ashrai 89. Ashrai Lv 1 2 pts. 11,125
  10. Avatar for rabamino12358 90. rabamino12358 Lv 1 2 pts. 11,114

Comments