Placeholder image of a protein
Icon representing a puzzle

1917: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
November 12, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups


  1. Avatar for Beta Folders 100 pts. 12,045
  2. Avatar for Go Science 2. Go Science 76 pts. 12,001
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 11,983
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 11,933
  5. Avatar for Contenders 5. Contenders 29 pts. 11,906
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 11,857
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 11,842
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 11,269
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 11,141
  10. Avatar for Team Canada 10. Team Canada 4 pts. 11,079

  1. Avatar for reich64 131. reich64 Lv 1 1 pt. 10,428
  2. Avatar for ume 132. ume Lv 1 1 pt. 10,348
  3. Avatar for figgy 133. figgy Lv 1 1 pt. 10,319
  4. Avatar for kms1601 134. kms1601 Lv 1 1 pt. 10,295
  5. Avatar for ivalnic 135. ivalnic Lv 1 1 pt. 10,279
  6. Avatar for aspadistra 136. aspadistra Lv 1 1 pt. 10,202
  7. Avatar for riverorivero90 137. riverorivero90 Lv 1 1 pt. 10,002
  8. Avatar for Susume 138. Susume Lv 1 1 pt. 9,953
  9. Avatar for kludbrook 139. kludbrook Lv 1 1 pt. 9,941
  10. Avatar for OsirisGDW 140. OsirisGDW Lv 1 1 pt. 9,941

Comments