Placeholder image of a protein
Icon representing a puzzle

1919: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,206
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 9,060
  3. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,958
  4. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,562
  5. Avatar for Window Group 16. Window Group 1 pt. 8,520
  6. Avatar for Fox Folds 17. Fox Folds 1 pt. 8,277

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,848
  2. Avatar for Deleted player 2. Deleted player 76 pts. 9,831
  3. Avatar for Galaxie 3. Galaxie Lv 1 56 pts. 9,801
  4. Avatar for alcor29 4. alcor29 Lv 1 41 pts. 9,771
  5. Avatar for alwen 5. alwen Lv 1 29 pts. 9,760
  6. Avatar for robgee 6. robgee Lv 1 20 pts. 9,759
  7. Avatar for Dhalion 7. Dhalion Lv 1 14 pts. 9,737
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 9 pts. 9,736
  9. Avatar for silent gene 9. silent gene Lv 1 6 pts. 9,736
  10. Avatar for mirp 10. mirp Lv 1 4 pts. 9,736

Comments