Placeholder image of a protein
Icon representing a puzzle

1919: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
November 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,206
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 9,060
  3. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,958
  4. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,562
  5. Avatar for Window Group 16. Window Group 1 pt. 8,520
  6. Avatar for Fox Folds 17. Fox Folds 1 pt. 8,277

  1. Avatar for jawz101 61. jawz101 Lv 1 11 pts. 9,406
  2. Avatar for NeLikomSheet 62. NeLikomSheet Lv 1 10 pts. 9,403
  3. Avatar for zackallen 63. zackallen Lv 1 10 pts. 9,403
  4. Avatar for abiogenesis 64. abiogenesis Lv 1 10 pts. 9,381
  5. Avatar for stomjoh 65. stomjoh Lv 1 9 pts. 9,381
  6. Avatar for PeterDav 66. PeterDav Lv 1 9 pts. 9,380
  7. Avatar for P_hoenix88 67. P_hoenix88 Lv 1 8 pts. 9,379
  8. Avatar for fishercat 68. fishercat Lv 1 8 pts. 9,376
  9. Avatar for Pawel Tluscik 69. Pawel Tluscik Lv 1 8 pts. 9,369
  10. Avatar for alwen 70. alwen Lv 1 7 pts. 9,347

Comments