Placeholder image of a protein
Icon representing a puzzle

1919: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,848
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,837
  3. Avatar for Go Science 3. Go Science 54 pts. 9,743
  4. Avatar for Contenders 4. Contenders 38 pts. 9,697
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,694
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,676
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 9,667
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,605
  9. Avatar for Team China 9. Team China 5 pts. 9,303
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 9,295
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,848
  2. Avatar for Deleted player 2. Deleted player 76 pts. 9,831
  3. Avatar for Galaxie 3. Galaxie Lv 1 56 pts. 9,801
  4. Avatar for alcor29 4. alcor29 Lv 1 41 pts. 9,771
  5. Avatar for alwen 5. alwen Lv 1 29 pts. 9,760
  6. Avatar for robgee 6. robgee Lv 1 20 pts. 9,759
  7. Avatar for Dhalion 7. Dhalion Lv 1 14 pts. 9,737
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 9 pts. 9,736
  9. Avatar for silent gene 9. silent gene Lv 1 6 pts. 9,736
  10. Avatar for mirp 10. mirp Lv 1 4 pts. 9,736

Comments