Placeholder image of a protein
Icon representing a puzzle

1919: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,848
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,837
  3. Avatar for Go Science 3. Go Science 54 pts. 9,743
  4. Avatar for Contenders 4. Contenders 38 pts. 9,697
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,694
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 9,676
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 9,667
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,605
  9. Avatar for Team China 9. Team China 5 pts. 9,303
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 9,295
  1. Avatar for kyoota 11. kyoota Lv 1 2 pts. 9,735
  2. Avatar for MicElephant 12. MicElephant Lv 1 1 pt. 9,733
  3. Avatar for ichwilldiesennamen 13. ichwilldiesennamen Lv 1 1 pt. 9,720
  4. Avatar for pauldunn 14. pauldunn Lv 1 1 pt. 9,718
  5. Avatar for Bletchley Park 15. Bletchley Park Lv 1 1 pt. 9,697
  6. Avatar for jausmh 16. jausmh Lv 1 1 pt. 9,650
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 1 pt. 9,624
  8. Avatar for fisherlr777 18. fisherlr777 Lv 1 1 pt. 9,585
  9. Avatar for infjamc 19. infjamc Lv 1 1 pt. 9,421

Comments