Placeholder image of a protein
Icon representing a puzzle

1922: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 25, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 10,730
  2. Avatar for Russian team 12. Russian team 1 pt. 10,630
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,468
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,292
  5. Avatar for Team China 15. Team China 1 pt. 10,232
  6. Avatar for Fox Folds 16. Fox Folds 1 pt. 10,087
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,759
  1. Avatar for zeluis 91. zeluis Lv 1 3 pts. 10,722
  2. Avatar for LinchK 92. LinchK Lv 1 3 pts. 10,719
  3. Avatar for NPrincipi 93. NPrincipi Lv 1 3 pts. 10,682
  4. Avatar for sciencewalker 94. sciencewalker Lv 1 3 pts. 10,651
  5. Avatar for Gerom 95. Gerom Lv 1 2 pts. 10,630
  6. Avatar for roman madala 96. roman madala Lv 1 2 pts. 10,590
  7. Avatar for Todd6485577 97. Todd6485577 Lv 1 2 pts. 10,573
  8. Avatar for EileenS 98. EileenS Lv 1 2 pts. 10,508
  9. Avatar for ShadowTactics 99. ShadowTactics Lv 1 2 pts. 10,468
  10. Avatar for cbwest 100. cbwest Lv 1 2 pts. 10,449

Comments