Placeholder image of a protein
Icon representing a puzzle

1922: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 25, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 10,730
  2. Avatar for Russian team 12. Russian team 1 pt. 10,630
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,468
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,292
  5. Avatar for Team China 15. Team China 1 pt. 10,232
  6. Avatar for Fox Folds 16. Fox Folds 1 pt. 10,087
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,759
  1. Avatar for pascal ochem 111. pascal ochem Lv 1 1 pt. 10,280
  2. Avatar for AlkiP0Ps 112. AlkiP0Ps Lv 1 1 pt. 10,277
  3. Avatar for Alex333 113. Alex333 Lv 1 1 pt. 10,267
  4. Avatar for Sydefecks 114. Sydefecks Lv 1 1 pt. 10,267
  5. Avatar for Dr.Sillem 115. Dr.Sillem Lv 1 1 pt. 10,258
  6. Avatar for Bufur 116. Bufur Lv 1 1 pt. 10,254
  7. Avatar for Mike Cassidy 117. Mike Cassidy Lv 1 1 pt. 10,244
  8. Avatar for pizpot 118. pizpot Lv 1 1 pt. 10,243
  9. Avatar for zo3xiaJonWeinberg 119. zo3xiaJonWeinberg Lv 1 1 pt. 10,232
  10. Avatar for illex 120. illex Lv 1 1 pt. 10,216

Comments