Placeholder image of a protein
Icon representing a puzzle

1922: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 25, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 10,730
  2. Avatar for Russian team 12. Russian team 1 pt. 10,630
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,468
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,292
  5. Avatar for Team China 15. Team China 1 pt. 10,232
  6. Avatar for Fox Folds 16. Fox Folds 1 pt. 10,087
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,759
  1. Avatar for Mohoernchen 121. Mohoernchen Lv 1 1 pt. 10,189
  2. Avatar for SeoDongHyeon 122. SeoDongHyeon Lv 1 1 pt. 10,186
  3. Avatar for david05 123. david05 Lv 1 1 pt. 10,173
  4. Avatar for jihyunkim 124. jihyunkim Lv 1 1 pt. 10,164
  5. Avatar for pruneau_44 125. pruneau_44 Lv 1 1 pt. 10,164
  6. Avatar for wosser1 126. wosser1 Lv 1 1 pt. 10,158
  7. Avatar for 01010000 01001010 127. 01010000 01001010 Lv 1 1 pt. 10,151
  8. Avatar for Lights65 128. Lights65 Lv 1 1 pt. 10,135
  9. Avatar for hada 129. hada Lv 1 1 pt. 10,126
  10. Avatar for mvrlin 130. mvrlin Lv 1 1 pt. 10,124

Comments