Placeholder image of a protein
Icon representing a puzzle

1922: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 25, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 10,730
  2. Avatar for Russian team 12. Russian team 1 pt. 10,630
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,468
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,292
  5. Avatar for Team China 15. Team China 1 pt. 10,232
  6. Avatar for Fox Folds 16. Fox Folds 1 pt. 10,087
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,759
  1. Avatar for Eunseo 151. Eunseo Lv 1 1 pt. 9,672
  2. Avatar for MiauiKatze 152. MiauiKatze Lv 1 1 pt. 9,593
  3. Avatar for Eyluha 153. Eyluha Lv 1 1 pt. 9,502
  4. Avatar for geun yong 154. geun yong Lv 1 1 pt. 9,493
  5. Avatar for BAEMIN 155. BAEMIN Lv 1 1 pt. 9,489
  6. Avatar for minseohyun 156. minseohyun Lv 1 1 pt. 9,474
  7. Avatar for vesar16 157. vesar16 Lv 1 1 pt. 9,468
  8. Avatar for lss5769 158. lss5769 Lv 1 1 pt. 9,452
  9. Avatar for gavin.serna 159. gavin.serna Lv 1 1 pt. 9,449
  10. Avatar for Giorgia Pieristi 160. Giorgia Pieristi Lv 1 1 pt. 9,354

Comments