Placeholder image of a protein
Icon representing a puzzle

1922: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 25, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 10,730
  2. Avatar for Russian team 12. Russian team 1 pt. 10,630
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,468
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,292
  5. Avatar for Team China 15. Team China 1 pt. 10,232
  6. Avatar for Fox Folds 16. Fox Folds 1 pt. 10,087
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,759
  1. Avatar for mirp 11. mirp Lv 1 75 pts. 11,934
  2. Avatar for Skippysk8s 12. Skippysk8s Lv 1 73 pts. 11,927
  3. Avatar for Bletchley Park 13. Bletchley Park Lv 1 70 pts. 11,926
  4. Avatar for johnmitch 14. johnmitch Lv 1 68 pts. 11,923
  5. Avatar for Blipperman 15. Blipperman Lv 1 66 pts. 11,915
  6. Avatar for Enzyme 16. Enzyme Lv 1 64 pts. 11,903
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 62 pts. 11,894
  8. Avatar for nicobul 18. nicobul Lv 1 60 pts. 11,893
  9. Avatar for robgee 19. robgee Lv 1 58 pts. 11,892
  10. Avatar for Bruno Kestemont 20. Bruno Kestemont Lv 1 56 pts. 11,890

Comments