Placeholder image of a protein
Icon representing a puzzle

1922: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 25, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 10,730
  2. Avatar for Russian team 12. Russian team 1 pt. 10,630
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,468
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,292
  5. Avatar for Team China 15. Team China 1 pt. 10,232
  6. Avatar for Fox Folds 16. Fox Folds 1 pt. 10,087
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,759
  1. Avatar for silent gene 21. silent gene Lv 1 55 pts. 11,873
  2. Avatar for Phyx 22. Phyx Lv 1 53 pts. 11,868
  3. Avatar for jobo0502 23. jobo0502 Lv 1 51 pts. 11,867
  4. Avatar for TurtleByte 24. TurtleByte Lv 1 50 pts. 11,862
  5. Avatar for pauldunn 25. pauldunn Lv 1 48 pts. 11,840
  6. Avatar for NinjaGreg 26. NinjaGreg Lv 1 46 pts. 11,834
  7. Avatar for manu8170 27. manu8170 Lv 1 45 pts. 11,825
  8. Avatar for John McLeod 28. John McLeod Lv 1 43 pts. 11,817
  9. Avatar for GuR0 29. GuR0 Lv 1 42 pts. 11,801
  10. Avatar for ichwilldiesennamen 30. ichwilldiesennamen Lv 1 40 pts. 11,799

Comments