Placeholder image of a protein
Icon representing a puzzle

1922: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 25, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 10,730
  2. Avatar for Russian team 12. Russian team 1 pt. 10,630
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,468
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,292
  5. Avatar for Team China 15. Team China 1 pt. 10,232
  6. Avatar for Fox Folds 16. Fox Folds 1 pt. 10,087
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,759

  1. Avatar for Steven Pletsch 31. Steven Pletsch Lv 1 39 pts. 11,785
  2. Avatar for jausmh 32. jausmh Lv 1 38 pts. 11,783
  3. Avatar for g_b 33. g_b Lv 1 36 pts. 11,760
  4. Avatar for ucad 34. ucad Lv 1 35 pts. 11,752
  5. Avatar for aznarog 35. aznarog Lv 1 34 pts. 11,738
  6. Avatar for Deleted player 36. Deleted player 33 pts. 11,701
  7. Avatar for dpmattingly 37. dpmattingly Lv 1 32 pts. 11,693
  8. Avatar for Lotus23 38. Lotus23 Lv 1 31 pts. 11,663
  9. Avatar for Norrjane 39. Norrjane Lv 1 29 pts. 11,630
  10. Avatar for fiendish_ghoul 40. fiendish_ghoul Lv 1 28 pts. 11,614

Comments