Placeholder image of a protein
Icon representing a puzzle

1922: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 25, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 10,730
  2. Avatar for Russian team 12. Russian team 1 pt. 10,630
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,468
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,292
  5. Avatar for Team China 15. Team China 1 pt. 10,232
  6. Avatar for Fox Folds 16. Fox Folds 1 pt. 10,087
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,759
  1. Avatar for maithra 41. maithra Lv 1 27 pts. 11,605
  2. Avatar for ProfVince 42. ProfVince Lv 1 26 pts. 11,586
  3. Avatar for WBarme1234 43. WBarme1234 Lv 1 25 pts. 11,583
  4. Avatar for fpc 44. fpc Lv 1 24 pts. 11,565
  5. Avatar for phi16 45. phi16 Lv 1 24 pts. 11,556
  6. Avatar for Formula350 46. Formula350 Lv 1 23 pts. 11,555
  7. Avatar for akaaka 47. akaaka Lv 1 22 pts. 11,536
  8. Avatar for Anfinsen_slept_here 48. Anfinsen_slept_here Lv 1 21 pts. 11,533
  9. Avatar for heather-1 49. heather-1 Lv 1 20 pts. 11,526
  10. Avatar for stomjoh 50. stomjoh Lv 1 19 pts. 11,523

Comments