Placeholder image of a protein
Icon representing a puzzle

1922: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 25, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 10,730
  2. Avatar for Russian team 12. Russian team 1 pt. 10,630
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,468
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,292
  5. Avatar for Team China 15. Team China 1 pt. 10,232
  6. Avatar for Fox Folds 16. Fox Folds 1 pt. 10,087
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,759
  1. Avatar for fishercat 51. fishercat Lv 1 19 pts. 11,456
  2. Avatar for drumpeter18yrs9yrs 52. drumpeter18yrs9yrs Lv 1 18 pts. 11,428
  3. Avatar for jsfoldingaccount 53. jsfoldingaccount Lv 1 17 pts. 11,385
  4. Avatar for Tygh 54. Tygh Lv 1 17 pts. 11,361
  5. Avatar for NeLikomSheet 55. NeLikomSheet Lv 1 16 pts. 11,338
  6. Avatar for equilibria 56. equilibria Lv 1 15 pts. 11,315
  7. Avatar for alcor29 57. alcor29 Lv 1 15 pts. 11,285
  8. Avatar for OWM3 58. OWM3 Lv 1 14 pts. 11,275
  9. Avatar for CAN1958 59. CAN1958 Lv 1 13 pts. 11,243
  10. Avatar for alwen 60. alwen Lv 1 13 pts. 11,228

Comments