Placeholder image of a protein
Icon representing a puzzle

1922: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 25, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 10,730
  2. Avatar for Russian team 12. Russian team 1 pt. 10,630
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,468
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,292
  5. Avatar for Team China 15. Team China 1 pt. 10,232
  6. Avatar for Fox Folds 16. Fox Folds 1 pt. 10,087
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,759
  1. Avatar for martinzblavy 61. martinzblavy Lv 1 12 pts. 11,208
  2. Avatar for Vinara 62. Vinara Lv 1 12 pts. 11,208
  3. Avatar for BarrySampson 63. BarrySampson Lv 1 11 pts. 11,155
  4. Avatar for cjddig 64. cjddig Lv 1 11 pts. 11,128
  5. Avatar for Deleted player 65. Deleted player pts. 11,074
  6. Avatar for martin.kendig@verizon.net 66. martin.kendig@verizon.net Lv 1 10 pts. 11,033
  7. Avatar for Pawel Tluscik 67. Pawel Tluscik Lv 1 10 pts. 11,016
  8. Avatar for xythus 68. xythus Lv 1 9 pts. 11,015
  9. Avatar for infjamc 69. infjamc Lv 1 9 pts. 10,996
  10. Avatar for Simek 70. Simek Lv 1 8 pts. 10,973

Comments