Placeholder image of a protein
Icon representing a puzzle

1922: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 25, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 10,730
  2. Avatar for Russian team 12. Russian team 1 pt. 10,630
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,468
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,292
  5. Avatar for Team China 15. Team China 1 pt. 10,232
  6. Avatar for Fox Folds 16. Fox Folds 1 pt. 10,087
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,759
  1. Avatar for donuts554 71. donuts554 Lv 1 8 pts. 10,956
  2. Avatar for tracybutt 72. tracybutt Lv 1 8 pts. 10,934
  3. Avatar for abiogenesis 73. abiogenesis Lv 1 7 pts. 10,909
  4. Avatar for kevin everington 74. kevin everington Lv 1 7 pts. 10,875
  5. Avatar for pfirth 75. pfirth Lv 1 7 pts. 10,859
  6. Avatar for carsonfb 76. carsonfb Lv 1 6 pts. 10,848
  7. Avatar for Hellcat6 77. Hellcat6 Lv 1 6 pts. 10,846
  8. Avatar for ume 78. ume Lv 1 6 pts. 10,798
  9. Avatar for SKSbell 79. SKSbell Lv 1 5 pts. 10,793
  10. Avatar for Jumper2 80. Jumper2 Lv 1 5 pts. 10,792

Comments