Placeholder image of a protein
Icon representing a puzzle

1922: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 25, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 10,730
  2. Avatar for Russian team 12. Russian team 1 pt. 10,630
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,468
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,292
  5. Avatar for Team China 15. Team China 1 pt. 10,232
  6. Avatar for Fox Folds 16. Fox Folds 1 pt. 10,087
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 8,759

  1. Avatar for rabamino12358 81. rabamino12358 Lv 1 5 pts. 10,784
  2. Avatar for Ashrai 82. Ashrai Lv 1 5 pts. 10,780
  3. Avatar for JasperD 83. JasperD Lv 1 5 pts. 10,776
  4. Avatar for haggisfam 84. haggisfam Lv 1 4 pts. 10,749
  5. Avatar for gurch 85. gurch Lv 1 4 pts. 10,739
  6. Avatar for Trajan464 86. Trajan464 Lv 1 4 pts. 10,736
  7. Avatar for kyoota 87. kyoota Lv 1 4 pts. 10,731
  8. Avatar for Tlaloc 88. Tlaloc Lv 1 4 pts. 10,730
  9. Avatar for rezaefar 89. rezaefar Lv 1 3 pts. 10,727
  10. Avatar for j.a.stranger 90. j.a.stranger Lv 1 3 pts. 10,725

Comments