Placeholder image of a protein
Icon representing a puzzle

1922: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 25, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Go Science 100 pts. 12,030
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 12,009
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,976
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 11,974
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 11,927
  6. Avatar for Contenders 6. Contenders 16 pts. 11,926
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,831
  8. Avatar for Hold My Beer 8. Hold My Beer 6 pts. 11,785
  9. Avatar for Void Crushers 9. Void Crushers 4 pts. 10,973
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 10,776

  1. Avatar for BootsMcGraw 11. BootsMcGraw Lv 1 4 pts. 11,867
  2. Avatar for phi16 12. phi16 Lv 1 2 pts. 11,836
  3. Avatar for jausmh 13. jausmh Lv 1 2 pts. 11,831
  4. Avatar for alcor29 14. alcor29 Lv 1 1 pt. 11,826
  5. Avatar for fpc 15. fpc Lv 1 1 pt. 11,811
  6. Avatar for Blipperman 16. Blipperman Lv 1 1 pt. 11,677
  7. Avatar for OWM3 17. OWM3 Lv 1 1 pt. 11,468
  8. Avatar for cjddig 18. cjddig Lv 1 1 pt. 11,424
  9. Avatar for Keresto 19. Keresto Lv 1 1 pt. 11,248
  10. Avatar for infjamc 20. infjamc Lv 1 1 pt. 10,992

Comments