Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,813
  2. Avatar for Deleted group 12. Deleted group pts. 10,781
  3. Avatar for Team China 13. Team China 1 pt. 10,661
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,491
  5. Avatar for Fox Folds 15. Fox Folds 1 pt. 10,275
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 10,180

  1. Avatar for Dhalion
    1. Dhalion Lv 1
    100 pts. 11,573
  2. Avatar for mirp 2. mirp Lv 1 76 pts. 11,567
  3. Avatar for Galaxie 3. Galaxie Lv 1 56 pts. 11,567
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 41 pts. 11,564
  5. Avatar for argyrw 5. argyrw Lv 1 29 pts. 11,564
  6. Avatar for ichwilldiesennamen 6. ichwilldiesennamen Lv 1 20 pts. 11,564
  7. Avatar for kyoota 7. kyoota Lv 1 14 pts. 11,563
  8. Avatar for silent gene 8. silent gene Lv 1 9 pts. 11,561
  9. Avatar for alcor29 9. alcor29 Lv 1 6 pts. 11,522
  10. Avatar for fisherlr777 10. fisherlr777 Lv 1 4 pts. 11,518

Comments