Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,813
  2. Avatar for Deleted group 12. Deleted group pts. 10,781
  3. Avatar for Team China 13. Team China 1 pt. 10,661
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,491
  5. Avatar for Fox Folds 15. Fox Folds 1 pt. 10,275
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 10,180

  1. Avatar for Aubade01
    1. Aubade01 Lv 1
    100 pts. 11,621
  2. Avatar for grogar7 2. grogar7 Lv 1 98 pts. 11,602
  3. Avatar for Enzyme 3. Enzyme Lv 1 95 pts. 11,587
  4. Avatar for ZeroLeak7 4. ZeroLeak7 Lv 1 92 pts. 11,584
  5. Avatar for LociOiling 5. LociOiling Lv 1 89 pts. 11,528
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 86 pts. 11,528
  7. Avatar for ichwilldiesennamen 7. ichwilldiesennamen Lv 1 84 pts. 11,522
  8. Avatar for MicElephant 8. MicElephant Lv 1 81 pts. 11,427
  9. Avatar for christioanchauvin 9. christioanchauvin Lv 1 78 pts. 11,416
  10. Avatar for robgee 10. robgee Lv 1 76 pts. 11,367

Comments