Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,813
  2. Avatar for Deleted group 12. Deleted group pts. 10,781
  3. Avatar for Team China 13. Team China 1 pt. 10,661
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,491
  5. Avatar for Fox Folds 15. Fox Folds 1 pt. 10,275
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 10,180
  1. Avatar for equilibria 91. equilibria Lv 1 2 pts. 10,740
  2. Avatar for xythus 92. xythus Lv 1 2 pts. 10,739
  3. Avatar for CAN1958 93. CAN1958 Lv 1 2 pts. 10,717
  4. Avatar for zo3xiaJonWeinberg 94. zo3xiaJonWeinberg Lv 1 2 pts. 10,661
  5. Avatar for dahast.de 95. dahast.de Lv 1 2 pts. 10,648
  6. Avatar for zippyc137 96. zippyc137 Lv 1 2 pts. 10,612
  7. Avatar for infjamc 97. infjamc Lv 1 2 pts. 10,595
  8. Avatar for bupeldox 98. bupeldox Lv 1 2 pts. 10,589
  9. Avatar for Datstandin 99. Datstandin Lv 1 2 pts. 10,516
  10. Avatar for Threeoak 100. Threeoak Lv 1 2 pts. 10,510

Comments