Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,813
  2. Avatar for Deleted group 12. Deleted group pts. 10,781
  3. Avatar for Team China 13. Team China 1 pt. 10,661
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,491
  5. Avatar for Fox Folds 15. Fox Folds 1 pt. 10,275
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 10,180
  1. Avatar for smusso27 121. smusso27 Lv 1 1 pt. 10,275
  2. Avatar for HisH 122. HisH Lv 1 1 pt. 10,271
  3. Avatar for chris69300 123. chris69300 Lv 1 1 pt. 10,269
  4. Avatar for mvrlin 124. mvrlin Lv 1 1 pt. 10,256
  5. Avatar for Mohoernchen 125. Mohoernchen Lv 1 1 pt. 10,254
  6. Avatar for Sydefecks 126. Sydefecks Lv 1 1 pt. 10,246
  7. Avatar for REDing 127. REDing Lv 1 1 pt. 10,235
  8. Avatar for fillament 128. fillament Lv 1 1 pt. 10,233
  9. Avatar for Laks 129. Laks Lv 1 1 pt. 10,232
  10. Avatar for soph_v13 130. soph_v13 Lv 1 1 pt. 10,215

Comments