Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,813
  2. Avatar for Deleted group 12. Deleted group pts. 10,781
  3. Avatar for Team China 13. Team China 1 pt. 10,661
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,491
  5. Avatar for Fox Folds 15. Fox Folds 1 pt. 10,275
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 10,180
  1. Avatar for Uast 151. Uast Lv 1 1 pt. 9,145
  2. Avatar for joshmiller 152. joshmiller Lv 1 1 pt. 9,090
  3. Avatar for edu_test 153. edu_test Lv 1 1 pt. 9,090
  4. Avatar for burgerz 154. burgerz Lv 1 1 pt. 9,090
  5. Avatar for edamozonio 155. edamozonio Lv 1 1 pt. 9,090
  6. Avatar for malitha-ratnaweera 156. malitha-ratnaweera Lv 1 1 pt. 9,090
  7. Avatar for saxo98 157. saxo98 Lv 1 1 pt. 9,090
  8. Avatar for Timo van der Laan 158. Timo van der Laan Lv 1 1 pt. 9,090
  9. Avatar for Irisjz 159. Irisjz Lv 1 1 pt. 9,090
  10. Avatar for Michelle_L 160. Michelle_L Lv 1 1 pt. 9,090

Comments