Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,813
  2. Avatar for Deleted group 12. Deleted group pts. 10,781
  3. Avatar for Team China 13. Team China 1 pt. 10,661
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,491
  5. Avatar for Fox Folds 15. Fox Folds 1 pt. 10,275
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 10,180
  1. Avatar for Deleted player 11. Deleted player 74 pts. 11,364
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 71 pts. 11,362
  3. Avatar for ucad 13. ucad Lv 1 69 pts. 11,356
  4. Avatar for mirp 14. mirp Lv 1 67 pts. 11,347
  5. Avatar for johnmitch 15. johnmitch Lv 1 65 pts. 11,337
  6. Avatar for aznarog 16. aznarog Lv 1 63 pts. 11,332
  7. Avatar for phi16 17. phi16 Lv 1 61 pts. 11,312
  8. Avatar for jobo0502 18. jobo0502 Lv 1 59 pts. 11,311
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 57 pts. 11,311
  10. Avatar for g_b 20. g_b Lv 1 55 pts. 11,298

Comments