Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,813
  2. Avatar for Deleted group 12. Deleted group pts. 10,781
  3. Avatar for Team China 13. Team China 1 pt. 10,661
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,491
  5. Avatar for Fox Folds 15. Fox Folds 1 pt. 10,275
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 10,180
  1. Avatar for Galaxie 21. Galaxie Lv 1 53 pts. 11,296
  2. Avatar for nicobul 22. nicobul Lv 1 51 pts. 11,290
  3. Avatar for Bletchley Park 23. Bletchley Park Lv 1 49 pts. 11,275
  4. Avatar for WBarme1234 24. WBarme1234 Lv 1 48 pts. 11,260
  5. Avatar for silent gene 25. silent gene Lv 1 46 pts. 11,259
  6. Avatar for maithra 26. maithra Lv 1 44 pts. 11,252
  7. Avatar for Lotus23 27. Lotus23 Lv 1 43 pts. 11,252
  8. Avatar for BootsMcGraw 28. BootsMcGraw Lv 1 41 pts. 11,252
  9. Avatar for guineapig 29. guineapig Lv 1 40 pts. 11,251
  10. Avatar for fishercat 30. fishercat Lv 1 39 pts. 11,249

Comments