Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,813
  2. Avatar for Deleted group 12. Deleted group pts. 10,781
  3. Avatar for Team China 13. Team China 1 pt. 10,661
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,491
  5. Avatar for Fox Folds 15. Fox Folds 1 pt. 10,275
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 10,180
  1. Avatar for OWM3 61. OWM3 Lv 1 11 pts. 10,951
  2. Avatar for PeterDav 62. PeterDav Lv 1 10 pts. 10,940
  3. Avatar for jermainiac 63. jermainiac Lv 1 10 pts. 10,938
  4. Avatar for SKSbell 64. SKSbell Lv 1 10 pts. 10,931
  5. Avatar for martinzblavy 65. martinzblavy Lv 1 9 pts. 10,931
  6. Avatar for Pikkachurin 66. Pikkachurin Lv 1 9 pts. 10,929
  7. Avatar for Vinara 67. Vinara Lv 1 8 pts. 10,926
  8. Avatar for Ashrai 68. Ashrai Lv 1 8 pts. 10,910
  9. Avatar for kyoota 69. kyoota Lv 1 8 pts. 10,895
  10. Avatar for JasperD 70. JasperD Lv 1 7 pts. 10,886

Comments