Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,813
  2. Avatar for Deleted group 12. Deleted group pts. 10,781
  3. Avatar for Team China 13. Team China 1 pt. 10,661
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,491
  5. Avatar for Fox Folds 15. Fox Folds 1 pt. 10,275
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 10,180
  1. Avatar for Tygh 71. Tygh Lv 1 7 pts. 10,876
  2. Avatar for Todd6485577 72. Todd6485577 Lv 1 7 pts. 10,873
  3. Avatar for zannipietro 73. zannipietro Lv 1 6 pts. 10,868
  4. Avatar for ShadowTactics 74. ShadowTactics Lv 1 6 pts. 10,854
  5. Avatar for rabamino12358 75. rabamino12358 Lv 1 6 pts. 10,851
  6. Avatar for NPrincipi 76. NPrincipi Lv 1 5 pts. 10,848
  7. Avatar for alwen 77. alwen Lv 1 5 pts. 10,840
  8. Avatar for isaksson 78. isaksson Lv 1 5 pts. 10,840
  9. Avatar for tracybutt 79. tracybutt Lv 1 5 pts. 10,838
  10. Avatar for Keresto 80. Keresto Lv 1 4 pts. 10,821

Comments