Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,813
  2. Avatar for Deleted group 12. Deleted group pts. 10,781
  3. Avatar for Team China 13. Team China 1 pt. 10,661
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 10,491
  5. Avatar for Fox Folds 15. Fox Folds 1 pt. 10,275
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 10,180
  1. Avatar for Simek 81. Simek Lv 1 4 pts. 10,813
  2. Avatar for Dhalion 82. Dhalion Lv 1 4 pts. 10,811
  3. Avatar for abiogenesis 83. abiogenesis Lv 1 4 pts. 10,794
  4. Avatar for Hellcat6 84. Hellcat6 Lv 1 4 pts. 10,781
  5. Avatar for altaris 85. altaris Lv 1 3 pts. 10,781
  6. Avatar for Evica 86. Evica Lv 1 3 pts. 10,776
  7. Avatar for fearjuan 87. fearjuan Lv 1 3 pts. 10,749
  8. Avatar for rezaefar 88. rezaefar Lv 1 3 pts. 10,749
  9. Avatar for wosser1 89. wosser1 Lv 1 3 pts. 10,743
  10. Avatar for Jajaboman 90. Jajaboman Lv 1 3 pts. 10,741

Comments