Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,602
  2. Avatar for Gargleblasters 2. Gargleblasters 71 pts. 11,587
  3. Avatar for Go Science 3. Go Science 49 pts. 11,584
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 11,528
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,416
  6. Avatar for Contenders 6. Contenders 14 pts. 11,275
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,203
  8. Avatar for Russian team 8. Russian team 5 pts. 11,095
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 3 pts. 10,886
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,854
  1. Avatar for Dhalion
    1. Dhalion Lv 1
    100 pts. 11,573
  2. Avatar for mirp 2. mirp Lv 1 76 pts. 11,567
  3. Avatar for Galaxie 3. Galaxie Lv 1 56 pts. 11,567
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 41 pts. 11,564
  5. Avatar for argyrw 5. argyrw Lv 1 29 pts. 11,564
  6. Avatar for ichwilldiesennamen 6. ichwilldiesennamen Lv 1 20 pts. 11,564
  7. Avatar for kyoota 7. kyoota Lv 1 14 pts. 11,563
  8. Avatar for silent gene 8. silent gene Lv 1 9 pts. 11,561
  9. Avatar for alcor29 9. alcor29 Lv 1 6 pts. 11,522
  10. Avatar for fisherlr777 10. fisherlr777 Lv 1 4 pts. 11,518

Comments