Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,602
  2. Avatar for Gargleblasters 2. Gargleblasters 71 pts. 11,587
  3. Avatar for Go Science 3. Go Science 49 pts. 11,584
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 11,528
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,416
  6. Avatar for Contenders 6. Contenders 14 pts. 11,275
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,203
  8. Avatar for Russian team 8. Russian team 5 pts. 11,095
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 3 pts. 10,886
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,854

  1. Avatar for Uast 151. Uast Lv 1 1 pt. 9,145
  2. Avatar for joshmiller 152. joshmiller Lv 1 1 pt. 9,090
  3. Avatar for edu_test 153. edu_test Lv 1 1 pt. 9,090
  4. Avatar for edamozonio 154. edamozonio Lv 1 1 pt. 9,090
  5. Avatar for burgerz 155. burgerz Lv 1 1 pt. 9,090
  6. Avatar for malitha-ratnaweera 156. malitha-ratnaweera Lv 1 1 pt. 9,090
  7. Avatar for Timo van der Laan 157. Timo van der Laan Lv 1 1 pt. 9,090
  8. Avatar for Irisjz 158. Irisjz Lv 1 1 pt. 9,090
  9. Avatar for Michelle_L 159. Michelle_L Lv 1 1 pt. 9,090
  10. Avatar for ekrause1406 160. ekrause1406 Lv 1 1 pt. 9,090

Comments