Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,602
  2. Avatar for Gargleblasters 2. Gargleblasters 71 pts. 11,587
  3. Avatar for Go Science 3. Go Science 49 pts. 11,584
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 11,528
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,416
  6. Avatar for Contenders 6. Contenders 14 pts. 11,275
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,203
  8. Avatar for Russian team 8. Russian team 5 pts. 11,095
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 3 pts. 10,886
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,854

  1. Avatar for Deleted player 11. Deleted player 74 pts. 11,364
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 71 pts. 11,362
  3. Avatar for ucad 13. ucad Lv 1 69 pts. 11,356
  4. Avatar for mirp 14. mirp Lv 1 67 pts. 11,347
  5. Avatar for johnmitch 15. johnmitch Lv 1 65 pts. 11,337
  6. Avatar for aznarog 16. aznarog Lv 1 63 pts. 11,332
  7. Avatar for phi16 17. phi16 Lv 1 61 pts. 11,312
  8. Avatar for jobo0502 18. jobo0502 Lv 1 59 pts. 11,311
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 57 pts. 11,311
  10. Avatar for g_b 20. g_b Lv 1 55 pts. 11,298

Comments