Placeholder image of a protein
Icon representing a puzzle

1925: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
December 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,602
  2. Avatar for Gargleblasters 2. Gargleblasters 71 pts. 11,587
  3. Avatar for Go Science 3. Go Science 49 pts. 11,584
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 11,528
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,416
  6. Avatar for Contenders 6. Contenders 14 pts. 11,275
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 11,203
  8. Avatar for Russian team 8. Russian team 5 pts. 11,095
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 3 pts. 10,886
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 10,854

  1. Avatar for Galaxie 21. Galaxie Lv 1 53 pts. 11,296
  2. Avatar for nicobul 22. nicobul Lv 1 51 pts. 11,290
  3. Avatar for Bletchley Park 23. Bletchley Park Lv 1 49 pts. 11,275
  4. Avatar for WBarme1234 24. WBarme1234 Lv 1 48 pts. 11,260
  5. Avatar for silent gene 25. silent gene Lv 1 46 pts. 11,259
  6. Avatar for maithra 26. maithra Lv 1 44 pts. 11,252
  7. Avatar for Lotus23 27. Lotus23 Lv 1 43 pts. 11,252
  8. Avatar for BootsMcGraw 28. BootsMcGraw Lv 1 41 pts. 11,252
  9. Avatar for guineapig 29. guineapig Lv 1 40 pts. 11,251
  10. Avatar for fishercat 30. fishercat Lv 1 39 pts. 11,249

Comments