Placeholder image of a protein
Icon representing a puzzle

1928: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
December 10, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 11,205
  2. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,944
  3. Avatar for Fox Folds 14. Fox Folds 1 pt. 10,944
  4. Avatar for Deleted group 15. Deleted group pts. 10,867
  5. Avatar for MAB_STEM 16. MAB_STEM 1 pt. 10,846
  6. Avatar for Hold My Beer 17. Hold My Beer 1 pt. 10,786
  7. Avatar for Window Group 18. Window Group 1 pt. 8,991
  8. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 8,975

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,390
  2. Avatar for Deleted player 2. Deleted player 71 pts. 12,379
  3. Avatar for Galaxie 3. Galaxie Lv 1 49 pts. 12,186
  4. Avatar for robgee 4. robgee Lv 1 33 pts. 12,112
  5. Avatar for Dhalion 5. Dhalion Lv 1 22 pts. 12,104
  6. Avatar for mirp 6. mirp Lv 1 14 pts. 12,104
  7. Avatar for kyoota 7. kyoota Lv 1 8 pts. 12,101
  8. Avatar for silent gene 8. silent gene Lv 1 5 pts. 12,099
  9. Avatar for pauldunn 9. pauldunn Lv 1 3 pts. 12,097
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 2 pts. 12,073

Comments